PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016497146.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 262aa    MW: 29443.8 Da    PI: 10.4446
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016497146.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.93.6e-1059941247
                    HHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS
          SRF-TF 12 tfskRrngilKKAeELSvLCdaevaviifsstgkly 47
                    tfskRr+g+ KK +EL   C+++v ++  s+tgk +
  XP_016497146.1 59 TFSKRRAGLYKKSSELIAECGVDVGIVASSPTGKPF 94
                    9********************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.64740100IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-124099IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-1841111IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-84262IPR002100Transcription factor, MADS-box
PfamPF003191.7E-155096IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-86277IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-87798IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MTVALTELPT LTSGGFLNGR PLFLAMATKV GAVMVSKKTK GRQKIQMKKI VKRDDLFATF  60
SKRRAGLYKK SSELIAECGV DVGIVASSPT GKPFSFFHPT DDAVIARFQN PDMQLSQTTG  120
LVAAHAQNKV NSLNSRLEEL DTREDAAIAQ ARFYDKMIKT RQSGWWESIE QLNADEVTKF  180
EAWLKSEIYQ AEELEQSHLR ILGHRCSTVD AIYEPQKQFR AMWVVTAIAI LPPQKRARRS  240
GHSLHKRYRA ADAAIGPQKR NH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016497146.10.0PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLK4BSX12e-68K4BSX1_SOLLC; Uncharacterized protein
STRINGSolyc04g056740.1.16e-68(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38220138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-25AGAMOUS-like 62